PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000142583
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 223aa    MW: 25599.4 Da    PI: 9.4286
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000142583genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.11.6e-32144202159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK vk ++fprsYYrCt++gC+vkk+v+r ++d+ vv++tYeg H+h+
  MDP0000142583 144 LDDGYRWRKYGQKAVKANKFPRSYYRCTYEGCNVKKQVQRLSKDEGVVVTTYEGMHTHP 202
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.4E-33129202IPR003657WRKY domain
SuperFamilySSF1182906.93E-29136203IPR003657WRKY domain
PROSITE profilePS5081129.769139204IPR003657WRKY domain
SMARTSM007743.4E-38144203IPR003657WRKY domain
PfamPF031061.8E-26145202IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MEKYQMFFPC TSSANYPNPN STNIDHHHRV GSSHVYTNNF DGRVDQTSDA FLGLKSTMTT  60
TENHVGSSSD EVLVHKDGHP YQQYYQQHYP SANAGMSNVI VGADHSSVDP HRANNNDSGK  120
KKKGEKKMKK PKYAFQTRSQ VDILDDGYRW RKYGQKAVKA NKFPRSYYRC TYEGCNVKKQ  180
VQRLSKDEGV VVTTYEGMHT HPIDKPSDNF ERILNQMQIY TPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-27134203776Probable WRKY transcription factor 4
2lex_A3e-27134203776Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341671.11e-170PREDICTED: probable WRKY transcription factor 75
TrEMBLM5WY444e-99M5WY44_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s33560.11e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF115634110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.16e-54WRKY DNA-binding protein 75